Citrullination-Resistant LL-37 Is a Potent Antimicrobial Agent in the Inflammatory Environment High in Arginine Deiminase Activity
Abstract
:1. Introduction
2. Results
2.1. Antibacterial Activities of Native LL-37 and hArg-LL-37
2.2. Immunomodulatory Activities of Native LL-37 and hArg-LL-37
2.3. Sensitivities of Native LL-37 and hArg-LL-37 to Proteolysis
2.4. Antibacterial Properties of hArg-LL-37 in the Presence of Active PAD4
3. Discussion
4. Materials and Methods
4.1. Peptide Synthesis and Purification
4.2. Expression and Purification of Human Recombinant PAD4
4.3. Citrullination of LL-37 and hArg-LL-37 by Human PAD4
4.4. HPLC Analysis of Native and Modified LL-37/hArg-LL-37
4.5. Bacterial Strains and Cultures
4.6. Minimum Inhibitory Concentration (MIC)
4.7. Assessment of Bacterial Viability by Using the LIVE/DEAD BacLight KIT
4.8. Sytox Green Uptake Analysis
4.9. ThT Dye-Binding Assay
4.10. Isolation and Culture of Primary Cells
4.11. Cell Viability Test
4.12. Macrophages Stimulation
4.13. Measurement of Cytokine Levels in Whole Blood
4.14. Binding of LPS to RAW 264.7 Cells
4.15. Degradation of LL-37 and hArg-LL-37 by Human Proteases
4.16. NETs-Mediated Bacterial Killing in the Presence of LL-37 or hArg-LL-37
4.17. Statistical Analysis
Author Contributions
Funding
Conflicts of Interest
Abbreviations
NETs | neutrophil extracellular traps |
PAD | peptidyl-arginine deiminases |
AMPs | antimicrobial peptides |
LTA | lipoteichoic acid |
PGN | peptidoglycan |
IPTG | isopropyl β-D-1-thiogalactopyranoside |
BAEE | N-α-benzoyl-L-arginine ethyl ester hydrochloride |
PBS | phosphate buffered saline |
OD | optical density |
MIC | minimal inhibitory concentration |
CFU | colony forming units |
MHB | Mueller-Hinton broth |
PI | propidium iodide |
LB | Lennox broth |
ThT | thioflavin T |
PBMCs | peripheral blood mononuclear cell |
hMdMs | human monocyte-derived macrophages |
DMEM | Dulbecco’s Modified Eagle’s Medium |
FBS | fetal bovine serum |
LDH | lactate dehydrogenase |
RPMI | Roswell Park Memorial Institute Medium |
EDTA | ethylenediaminetetraacetic acid |
ELISA | enzyme-linked immunosorbent assay |
MOI | multiplicity of infection |
References
- Boman, H.G. Antibacterial peptides: Key components needed in immunity. Cell 1991, 65, 205–207. [Google Scholar] [CrossRef]
- Hancock, R.E.; Haney, E.F.; Gill, E.E. The immunology of host defence peptides: Beyond antimicrobial activity. Nat. Rev. Immunol. 2016, 16, 321–334. [Google Scholar] [CrossRef] [PubMed]
- Agerberth, B.; Gunne, H.; Odeberg, J.; Kogner, P.; Boman, H.G.; Gudmundsson, G.H. FALL-39, a putative human peptide antibiotic, is cysteine-free and expressed in bone marrow and testis. Proc. Natl. Acad. Sci. USA 1995, 92, 195–199. [Google Scholar] [CrossRef] [PubMed] [Green Version]
- Sørensen, O.E.; Follin, P.; Johnsen, A.H.; Calafat, J.; Tjabringa, G.S.; Hiemstra, P.S.; Borregaard, N. Human cathelicidin, hCAP-18, is processed to the antimicrobial peptide LL-37 by extracellular cleavage with proteinase 3. Blood 2001, 9, 3951–3959. [Google Scholar] [CrossRef] [PubMed] [Green Version]
- Yamasaki, K.; Schauber, J.; Coda, A.; Lin, H.; Dorschner, R.A.; Schechter, N.M.; Bonnart, C.; Descargues, P.; Hovnanian, A.; Gallo, R.L. Kallikrein-Mediated proteolysis regulates the antimicrobial effects of cathelicidins in skin. FASEB J. 2006, 20, 2068–2080. [Google Scholar] [CrossRef] [Green Version]
- Oren, Z.; Lerman, J.C.; Gudmundsson, G.H.; Agerberth, B.; Shai, Y. Structure and organization of the human antimicrobial peptide LL-37 in phospholipid membranes: Relevance to the molecular basis for its non-cell-selective activity. Biochem. J. 1999, 341, 501–513. [Google Scholar] [CrossRef]
- Travis, S.M.; Anderson, N.N.; Forsyth, W.R.; Espiritu, C.; Conway, B.D.; Greenberg, E.P.; McCray, P.B., Jr.; Lehrer, R.I.; Welsh, M.J.; Tack, B.F. Bactericidal activity of mammalian cathelicidin-derived peptides. Infect. Immun. 2000, 6, 2748–2755. [Google Scholar] [CrossRef] [Green Version]
- Nagaoka, I.; Hirota, S.; Niyonsaba, F.; Hirata, M.; Adachi, Y.; Tamura, H.; Tanaka, S.; Heumann, D. Augmentation of the lipopolysaccharide-neutralizing activities of human cathelicidin CAP18/LL-37-derived antimicrobial peptides by replacement with hydrophobic and cationic amino acid residues. Clin. Diagn. Lab. Immunol. 2002, 9, 972–982. [Google Scholar] [CrossRef] [Green Version]
- Cirioni, O.; Giacometti, A.; Ghiselli, R.; Bergnach, C.; Orlando, F.; Silvestri, C.; Mocchegiani, F.; Licci, A.; Skerlavaj, B.; Rocchi, M.; et al. LL-37 protects rats against lethal sepsis caused by gram-negative bacteria. Antimicrob. Agents Chemother. 2006, 50, 1672–1679. [Google Scholar] [CrossRef] [Green Version]
- Vossenaar, E.R.; Zendman, A.J.; van Venrooij, W.J.; Pruijn, G.J. PAD, a growing family of citrullinating enzymes: Genes, features and involvement in disease. Bioessays 2003, 25, 1106–1118. [Google Scholar] [CrossRef]
- Al-Adwani, S.; Wallin, C.; Balhuizen, M.D.; Veldhuizen, E.J.A.; Coorens, M.; Landreh, M.; Végvári, Á.; Smith, M.E.; Qvarfordt, I.; Lindén, A.; et al. Studies on citrullinated LL-37: Detection in human airways, antibacterial effects and biophysical properties. Sci. Rep. 2020, 10, 2376. [Google Scholar] [CrossRef] [PubMed]
- Wong, A.; Bryzek, D.; Dobosz, E.; Scavenius, C.; Svoboda, P.; Rapala-Kozik, M.; Lesner, A.; Frydrych, I.; Enghild, J.; Mydel, P.; et al. A novel biological role for peptidyl-arginine deiminases: Citrullination of Cathelicidin LL-37 controls the immunostimulatory potential of cell-free DNA. J. Immunol. 2018, 200, 2327–2340. [Google Scholar] [CrossRef] [PubMed] [Green Version]
- Kilsgård, O.; Andersson, P.; Malmsten, M.; Nordin, S.L.; Linge, H.M.; Eliasson, M.; Sörenson, E.; Erjefält, J.S.; Bylund, J.; Olin, A.I.; et al. Peptidylarginine deiminases present in the airways during tobacco smoking and inflammation can citrullinate the host defense peptide LL-37, resulting in altered activities. Am. J. Respir. Cell Mol. Biol. 2012, 46, 240–248. [Google Scholar] [CrossRef] [PubMed]
- Koziel, J.; Bryzek, D.; Sroka, A.; Maresz, K.; Glowczyk, I.; Bielecka, E.; Kantyka, T.; Pyrć, K.; Svoboda, P.; Pohl, J.; et al. Citrullination alters immunomodulatory function of LL-37 essential for prevention of endotoxin-induced sepsis. J. Immunol. 2014, 192, 5363–5372. [Google Scholar] [CrossRef] [PubMed] [Green Version]
- Méchin, M.C.; Sebbag, M.; Arnaud, J.; Nachat, R.; Foulquier, C.; Adoue, V.; Coudane, F.; Duplan, H.; Schmitt, A.M.; Chavanas, S.; et al. Update on peptidylarginine deiminases and deimination in skin physiology and severe human diseases. Int. J. Cosmet. Sci. 2007, 29, 147–168. [Google Scholar] [CrossRef] [PubMed]
- Foulquier, C.; Sebbag, M.; Clavel, C.; Chapuy-Regaud, S.; Al Badine, R.; Méchin, M.C.; Vincent, C.; Nachat, R.; Yamada, M.; Takahara, H.; et al. Peptidyl arginine deiminase type 2 (PAD-2) and PAD-4 but not PAD-1, PAD-3, and PAD-6 are expressed in rheumatoid arthritis synovium in close association with tissue inflammation. Arthritis Rheum. 2007, 56, 3541–3553. [Google Scholar] [CrossRef] [PubMed]
- Marshall, N.C.; Finlay, B.B.; Overall, C.M. Sharpening host defenses during infection: Proteases cut to the chase. Mol. Cell. Proteom. 2017, 16, S161–S171. [Google Scholar] [CrossRef] [Green Version]
- Sieprawska-Lupa, M.; Mydel, P.; Krawczyk, K.; Wójcik, K.; Puklo, M.; Lupa, B.; Suder, P.; Silberring, J.; Reed, M.; Pohl, J.; et al. Degradation of human antimicrobial peptide LL-37 by Staphylococcus aureus-derived proteinases. Antimicrob. Agents Chemother. 2004, 48, 4673–4679. [Google Scholar] [CrossRef] [Green Version]
- Brinkmann, V.; Reichard, U.; Goosmann, C.; Fauler, B.; Uhlemann, Y.; Weiss, D.S.; Weinrauch, Y.; Zychlinsky, A. Neutrophil extracellular traps kill bacteria. Science 2004, 303, 1532–1535. [Google Scholar] [CrossRef]
- Wang, Y.; Li, M.; Stadler, S.; Correll, S.; Li, P.; Wang, D.; Hayama, R.; Leonelli, L.; Han, H.; Grigoryev, S.A.; et al. Histone hypercitrullination mediates chromatin decondensation and neutrophil extracellular trap formation. J. Cell Biol. 2009, 184, 205–213. [Google Scholar] [CrossRef] [Green Version]
- Cooper, P.R.; Palmer, L.J.; Chapple, I.L. Neutrophil extracellular traps as a new paradigm in innate immunity: Friend or foe? Periodontology 2000 2013, 63, 165–197. [Google Scholar] [CrossRef] [PubMed]
- Wang, G. Human antimicrobial peptides and proteins. Pharmaceuticals 2014, 7, 545–594. [Google Scholar] [CrossRef] [PubMed] [Green Version]
- McCrudden, M.T.C.; McLean, D.T.F.; Zhou, M.; Shaw, J.; Linden, G.J.; Irwin, C.R.; Lundy, F.T. The host defence peptide LL-37 is susceptible to proteolytic degradation by wound fluid isolated from foot ulcers of diabetic patients. Int. J. Pept. Res. Ther. 2014, 20, 457–464. [Google Scholar] [CrossRef]
- Koro, C.; Hellvard, A.; Delaleu, N.; Binder, V.; Scavenius, C.; Bergum, B.; Główczyk, I.; Roberts, H.M.; Chapple, I.L.; Grant, M.M.; et al. Carbamylated LL-37 as a modulator of the immune response. Innate Immun. 2016, 22, 218–229. [Google Scholar] [CrossRef] [Green Version]
- Lande, R.; Palazzo, R.; Hammel, P.; Pietraforte, I.; Surbeck, I.; Gilliet, M.; Chizzolini, C.; Frasca, L. Generation of monoclonal antibodies specific for native LL37 and citrullinated LL37 that discriminate the two LL37 forms in the skin and circulation of cutaneous/systemic lupus erythematosus and rheumatoid arthritis patients. Antibodies 2020, 9, 14. [Google Scholar] [CrossRef]
- Rohrbach, A.S.; Slade, D.J.; Thompson, P.R.; Mowen, K.A. Activation of PAD4 in NET formation. Front. Immunol. 2012, 3, 360. [Google Scholar] [CrossRef] [Green Version]
- Lewis, H.D.; Liddle, J.; Coote, J.E.; Atkinson, S.J.; Barker, M.D.; Bax, B.D.; Bicker, K.L.; Bingham, R.P.; Campbell, M.; Chen, Y.H.; et al. Inhibition of PAD4 activity is sufficient to disrupt mouse and human NET formation. Nat. Chem. Biol. 2015, 11, 189–191. [Google Scholar] [CrossRef]
- Bryzek, D.; Ciaston, I.; Dobosz, E.; Gasiorek, A.; Makarska, A.; Sarna, M.; Eick, S.; Puklo, M.; Lech, M.; Potempa, B.; et al. Triggering NETosis via protease-activated receptor (PAR)-2 signaling as a mechanism of hijacking neutrophils function for pathogen benefits. PLoS Pathog. 2019, 15, e1007773. [Google Scholar] [CrossRef]
- Izdebski, J.; Kunce, D.; Schiller, P.W.; Chung, N.N.; Gers, T.; Zelman, M.; Grabek, M. Synthesis and biological activity of homoarginine-containing opioid peptides. J. Pept. Sci. 2007, 13, 27–30. [Google Scholar] [CrossRef]
- Chowdhury, S.M.; Munske, G.R.; Yang, J.; Zhukova, D.; Nguyen, H.; Bruce, J.E. Solid-Phase N-terminal peptide enrichment study by optimizing trypsin proteolysis on homoarginine-modified proteins by mass spectrometry. Rapid Commun. Mass Spectrom. 2014, 2, 635–644. [Google Scholar] [CrossRef]
- Rodionov, R.N.; Begmatov, H.; Jarzebska, N.; Patel, K.; Mills, M.T.; Ghani, Z.; Khakshour, D.; Tamboli, P.; Patel, M.N.; Abdalla, M.; et al. Homoarginine supplementation prevents left ventricular dilatation and preserves systolic function in a model of coronary artery disease. J. Am. Heart Assoc. 2019, 8, e012486. [Google Scholar] [CrossRef] [PubMed] [Green Version]
- Grönberg, A.; Mahlapuu, M.; Ståhle, M.; Whately-Smith, C.; Rollman, O. Treatment with LL-37 is safe and effective in enhancing healing of hard-to-heal venous leg ulcers: A randomized, placebo-controlled clinical trial. Wound Repair Regen. 2014, 22, 613–621. [Google Scholar] [CrossRef] [PubMed]
- Liao, Y.F.; Hsieh, H.C.; Liu, G.Y.; Hung, H.C. A continuous spectrophotometric assay method for peptidylarginine deiminase type 4 activity. Anal. Biochem. 2005, 347, 176–181. [Google Scholar] [CrossRef] [PubMed]
- Koziel, J.; Maciag-Gudowska, A.; Mikolajczyk, T.; Bzowska, M.; Sturdevant, D.E.; Whitney, A.R.; Shaw, L.N.; DeLeo, F.R.; Potempa, J. Phagocytosis of Staphylococcus aureus by macrophages exerts cytoprotective effects manifested by the upregulation of antiapoptotic factors. PLoS ONE 2009, 4, e5210. [Google Scholar] [CrossRef] [PubMed] [Green Version]
- Nagaoka, I.; Hirota, S.; Niyonsaba, F.; Hirata, M.; Adachi, Y.; Tamura, H.; Heumann, D. Cathelicidin family of antibacterial peptides CAP18 and CAP11 inhibit the expression of TNF-alpha by blocking the binding of LPS to CD14(+) cells. J. Immunol. 2001, 167, 3329–3338. [Google Scholar] [CrossRef] [PubMed] [Green Version]
Peptide | Sequence |
---|---|
LL-37 | [LL-37, 37 aa] |
hArg-LL-37 | LLGDFF(hR)KSKEKIGKEFK(hR)IVQ(hR)IKDFL(hR)NLVP(hR)TES |
Publisher’s Note: MDPI stays neutral with regard to jurisdictional claims in published maps and institutional affiliations. |
© 2020 by the authors. Licensee MDPI, Basel, Switzerland. This article is an open access article distributed under the terms and conditions of the Creative Commons Attribution (CC BY) license (http://creativecommons.org/licenses/by/4.0/).
Share and Cite
Bryzek, D.; Golda, A.; Budziaszek, J.; Kowalczyk, D.; Wong, A.; Bielecka, E.; Shakamuri, P.; Svoboda, P.; Pohl, J.; Potempa, J.; et al. Citrullination-Resistant LL-37 Is a Potent Antimicrobial Agent in the Inflammatory Environment High in Arginine Deiminase Activity. Int. J. Mol. Sci. 2020, 21, 9126. https://0-doi-org.brum.beds.ac.uk/10.3390/ijms21239126
Bryzek D, Golda A, Budziaszek J, Kowalczyk D, Wong A, Bielecka E, Shakamuri P, Svoboda P, Pohl J, Potempa J, et al. Citrullination-Resistant LL-37 Is a Potent Antimicrobial Agent in the Inflammatory Environment High in Arginine Deiminase Activity. International Journal of Molecular Sciences. 2020; 21(23):9126. https://0-doi-org.brum.beds.ac.uk/10.3390/ijms21239126
Chicago/Turabian StyleBryzek, Danuta, Anna Golda, Joanna Budziaszek, Dominik Kowalczyk, Alicia Wong, Ewa Bielecka, Priyanka Shakamuri, Pavel Svoboda, Jan Pohl, Jan Potempa, and et al. 2020. "Citrullination-Resistant LL-37 Is a Potent Antimicrobial Agent in the Inflammatory Environment High in Arginine Deiminase Activity" International Journal of Molecular Sciences 21, no. 23: 9126. https://0-doi-org.brum.beds.ac.uk/10.3390/ijms21239126